Scooby-domain applies the distribution of known domain sizes and averages hydrophobicities
in the CATH domain database to predict novel domains in sequence. The JAVA applet below applies a multi-level
smoothing window to average various properties of the amino acids. Hot spots in the output represent likely
domain centers based on the observed distribution of properties in the CATH domains; use the cursor to
identify the boundaries (limits) of the identified domain. Click here to return to the Scooby-domain submission page.
WARNING: some browsers have problems running JAVA applets,
this applet works well with Netscape. BUG: when scrolling the residue position of the mouse pointer will no longer be correct - this is a problem for microsoft users only.
(please read the Documentation)
>Example sequence
TTPQEDGFLRLKIASKEKIARDIWSFELTDPQGAPLPPFEAGANLTVAVPNGSRRTYSL
NDSQERNRYVIAVKRDSNGRGGSISFIDDTSEGDAVEVSLPRNEFPLDKRAKSFILVAG
IGITPMLSMARQLRAEGLRSFRLYYLTRDPEGTAFFDELTSDEWRSDVKIHHDHGDPTK
FDFWSVFEKSKPAQHVYCCGPQALMDTVRDMTGHWPSGTVHFESFGATNTNARENTPFT
RLSRSGTSFEIPANRSILEVLRDANVRVPSSCESGTCGSCKTALCSGEADHRDMVLRDD
KGTQIMVCVSRAKSAELVLDL
(c) IBIVU 2025. If you are experiencing problems with the
site, please contact the webmaster.